PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g47887.2.p
Common NameBRADI_2g47887, LOC100842650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 301aa    MW: 31779.6 Da    PI: 7.1164
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g47887.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.4e-191461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+lv++++ +G g+W++++r  g+ R++k+c++rw +yl
  Bradi2g47887.2.p 14 RGLWSPEEDEKLVKYITTHGHGCWSSVPRQAGLQRCGKSCRLRWINYL 61
                      788*******************************************97 PP

2Myb_DNA-binding53.74.7e-1767110146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg++++eE+ l++++++ lG++ W+ Ia++++ gRt++++k++w++
  Bradi2g47887.2.p  67 RGSFSQEEEALIIELHRVLGNR-WAQIAKHLP-GRTDNEVKNFWNS 110
                       899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.501961IPR017930Myb domain
SuperFamilySSF466898.99E-3012108IPR009057Homeodomain-like
SMARTSM007174.5E-131363IPR001005SANT/Myb domain
PfamPF002496.9E-161461IPR001005SANT/Myb domain
CDDcd001674.13E-121761No hitNo description
PROSITE profilePS5129427.32262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2665117IPR009057Homeodomain-like
SMARTSM007173.0E-1766114IPR001005SANT/Myb domain
PfamPF002499.9E-1667110IPR001005SANT/Myb domain
CDDcd001674.27E-1369109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGHHSCCNKQ KVRRGLWSPE EDEKLVKYIT THGHGCWSSV PRQAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SQEEEALIIE LHRVLGNRWA QIAKHLPGRT DNEVKNFWNS TIKKKLISQA  120
VGSLHAGGIP SPADLYYNIL DGAAGQAGGI AAAGCPSLSG LDHNAAQGGV TQSSPPSGWA  180
NFTSHPLFLP GADHLQYAVD GDFVRLCRSA DAYPENGAAA AGLMAHEAAG GASANDDDDR  240
SCSLPVFVEP KAGAFSAGPA MGPVVDFMDA ILGSSSTSAA SASSVDSFSA NTGMQLHWIP  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3729260.0AK372926.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3016B12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569661.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLI1HQU80.0I1HQU8_BRADI; Uncharacterized protein
STRINGBRADI2G47887.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128133035
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.22e-76myb domain protein 26